PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000548G0300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family ARF
Protein Properties Length: 986aa    MW: 110112 Da    PI: 6.4782
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000548G0300genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.67e-1610733499
                     SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                     ++l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+++F   ++++++l+++++r+
  PH01000548G0300 10 QELQARDIHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSLIFV--RDEKQQLLLGIRRA 73
                     48999*********************************************..5688889****997 PP

2Auxin_resp117.31.2e-3898181183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aahaa+++s+F+++YnPras++eFv++++k++kal+ +++s+GmRf+m fete+  +rr++Gt++g+sdldpvrW+nS+WrsL+
  PH01000548G0300  98 AAHAAANTSPFTIFYNPRASPTEFVIPFAKYQKALYgNQISLGMRFRMVFETEELGTRRYMGTITGISDLDPVRWKNSQWRSLQ 181
                      79**********************************9*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.18174IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-212101IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-24286IPR015300DNA-binding pseudobarrel domain
CDDcd100174.02E-10263No hitNo description
SMARTSM010190.0039374IPR003340B3 DNA binding domain
PfamPF023624.0E-13973IPR003340B3 DNA binding domain
PfamPF065073.2E-3398181IPR010525Auxin response factor
PfamPF023092.1E-7849937IPR033389AUX/IAA domain
PROSITE profilePS5174527.029852936IPR000270PB1 domain
SuperFamilySSF542774.9E-7873931No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 986 aa     Download sequence    Send to blast
MDFSMQPPAQ ELQARDIHDN VWTFRHIYRG QPKRHLLTTG WSLFVSGKRL FAGDSLIFVR  60
DEKQQLLLGI RRASRQPTNI SSSVLSSNSM HIGVLAAAAH AAANTSPFTI FYNPRASPTE  120
FVIPFAKYQK ALYGNQISLG MRFRMVFETE ELGTRRYMGT ITGISDLDPV RWKNSQWRSL  180
QVGWDESAAG ERRDRVSIWE TEPVAAPFFI CPQPFFGVKR PRQLEYVMFL SLSAHTQNDE  240
SSEMENLFKR AMPWLGDEVS IKDAQTQNTT IPGLSLAQWM NMNRQQSSSL ASTAMQSEYL  300
RSLSNPAMQN LGAADLARQL YVQNHHLQQN SIQFDSSKLP QQMQPLNDLS KATLLLNQLG  360
AITNHQDQKQ DAGNPQRQQQ TINQVIPLSQ VQANVVQAHV IVQNQMQQQQ HQQQRQQPSP  420
TQNQKGASGQ QLLLSHQQQD QNLQLQLQLQ QQLLFQQQQL QQQQLNKLPG QLVNLASQQS  480
QLSDQELQLQ LLQKLQQQSL MSQSAVTLSR LPPIQEQQKF LVDIQQQVSN SHSLAQQQMM  540
PQEESKASLQ ATPLPPPMQQ EQQQKLSRKQ VAPADVSELA FPPISSSSVI SKTGSAMMIP  600
GAAQSVLTEE ILYCSTSPST ANGNHLVQPT IGRNEHSMIS TEKVAQSTAP MLIPTSIEAV  660
TTTPIITKEL PKLNNNVKPS VSTSKLPNVV SDTHNFMKNA LLTDNLETAS SATSLWPSQT  720
DGLLHQGFPT SNFNQHQLFK DALPDVEMQG ADTSNSALFG MNNDGTLGFP METEGLLVNA  780
LDSVQYQNHI STDVEINYQM QKDAQQELST SMVSQSFGQS DIAFNSIDSA INDGAFLDRN  840
SWAPAPPSQR MRTFTKVYKR GAVGRSTDIG RFSGYEDLKH ALARMFGIEG QLEGRQRIGW  900
KLVYKDHEDD ILLLGDDPWE EFVNCVRCIR ILSPQEVQQM SLDGALGNNV LPNQTCSNSD  960
GGSAWRPRGD QNSRTPSIGP YDQFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A5e-931202187388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688452.10.0PREDICTED: auxin response factor 5, partial
SwissprotQ6Z2W30.0ARFE_ORYSJ; Auxin response factor 5
TrEMBLA0A0D3F0J70.0A0A0D3F0J7_9ORYZ; Auxin response factor
STRINGORGLA02G0031900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140935106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.11e-126auxin response factor 19